PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C022254P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family NAC
Protein Properties Length: 406aa    MW: 45183.4 Da    PI: 6.3742
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C022254P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1661.3e-51141421128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka...eekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                     +ppGfrFhPt+eel+++yL+kkv+ +k++l +vi++vd++k+ePwd+++k+k     +++wyfFs++dkky+tg+r+nrat++g+Wkatg+dk +
  MELO3C022254P1  14 VPPGFRFHPTEEELLQYYLRKKVSFDKIDL-DVIRDVDLNKLEPWDIQEKCKIgttPQNDWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKVI 107
                     69****************************.9***************964444222455************************************ PP

             NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     +s + + +g++ktLvfykgrap+g+k+dW+mheyrl
  MELO3C022254P1 108 YS-NCRRIGMRKTLVFYKGRAPHGQKSDWIMHEYRL 142
                     **.8889***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.09E-577179IPR003441NAC domain
PROSITE profilePS5100556.00214179IPR003441NAC domain
PfamPF023653.2E-2715142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009809Biological Processlignin biosynthetic process
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0009901Biological Processanther dehiscence
GO:0010047Biological Processfruit dehiscence
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 406 aa     Download sequence    Send to blast
MPKMSISVNG QSQVPPGFRF HPTEEELLQY YLRKKVSFDK IDLDVIRDVD LNKLEPWDIQ  60
EKCKIGTTPQ NDWYFFSHKD KKYPTGTRTN RATAAGFWKA TGRDKVIYSN CRRIGMRKTL  120
VFYKGRAPHG QKSDWIMHEY RLDENSTSES NNMMKASSVV VIGDGGQEEG WVVCRIFKKK  180
NHHKTLDSPM STTTNETTSS LLLDSCNNDG ALDQIIHYMG RTCKEIIEED QEDEDGIGMG  240
AGRLLHPIDT SSVVINGSGS YLDGRFSKLP SLESPNSTST HNCYQPINNH MGPTDPMIVS  300
GYQLDSSSVS SAPHNWAAFD RLVASQLNGQ VEVSNMIYYS DQLPTTTTLR GTTSFSSKSS  360
SSSYNAVVAA AATATQDYNN VDTELWSFAR LSSTDPLCHV SDTTI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A5e-4881829171Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00321DAPTransfer from AT2G46770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819250.0LN681925.1 Cucumis melo genomic scaffold, anchoredscaffold00052.
GenBankLN7132650.0LN713265.1 Cucumis melo genomic chromosome, chr_11.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008459751.10.0PREDICTED: NAC domain-containing protein 43
SwissprotQ84WP61e-136NAC43_ARATH; NAC domain-containing protein 43
TrEMBLA0A0A0KDU50.0A0A0A0KDU5_CUCSA; Uncharacterized protein
STRINGVIT_15s0048g02660.t011e-153(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF30313374
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46770.11e-116NAC family protein